| Edit |   |
|---|
| Antigenic Specificity | THO Complex 4 (THOC4) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | THOC4 is a heat stable, nuclear protein and functions as a molecular chaperone. It is thought to regulate dimerization, DNA binding, and transcriptional activity of basic region-leucine zipper (bZIP) proteins. |
|---|
| Immunogen | THOC4 antibody was raised using the N terminal of THOC4 corresponding to a region with amino acids GGGPIRNRPAIARGAAGGGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGA |
|---|
| Other Names | THOC4|Aly|ALY|ALY/REF|BEF|REF|tho4|thoc4|zgc:171753|Tho4-A|alyref-a|thoc4-a|REF1|Refbp1|Thoc4|Tho4 |
|---|
| Gene, Accession # | Gene ID: 10189,21681,690585 |
|---|
| Catalog # | ABIN629900 |
|---|
| Price | |
|---|
| Order / More Info | THO Complex 4 (THOC4) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|