| Edit |   |
| Antigenic Specificity | REEP5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 84%, rat 86%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 µl |
| Concentration | n/a |
| Applications | ICC-IF |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human REEP5 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEE |
| Other Names | receptor accessory protein 5, C5orf18, D5S346, DP1, TB2 |
| Gene, Accession # | Gene ID: 7905, UniProt: Q00765, ENSG00000129625 |
| Catalog # | HPA069960 |
| Price | |
| Order / More Info | REEP5 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |