| Edit |   |
| Antigenic Specificity | ATP6V0D2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 86%, rat 86%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 µl |
| Concentration | n/a |
| Applications | IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human ATP6V0D2 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: EDRETLYPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSG |
| Other Names | ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2, ATP6D2, FLJ38708, VMA6 |
| Gene, Accession # | Gene ID: 245972, UniProt: Q8N8Y2, ENSG00000147614 |
| Catalog # | HPA055327 |
| Price | |
| Order / More Info | ATP6V0D2 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |