| Edit |   |
| Antigenic Specificity | DYRK4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 44%, rat 44%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 µl |
| Concentration | n/a |
| Applications | ICC-IF, IHC. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human DYRK4 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: GDQQDCLQHGADTVQLPQLVDAPKKSEAAVGAEVSMTSPGQSKNFSLKNTNV |
| Other Names | dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4 |
| Gene, Accession # | Gene ID: 8798, UniProt: Q9NR20, ENSG00000010219 |
| Catalog # | HPA056073 |
| Price | |
| Order / More Info | DYRK4 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |