| Edit |   |
|---|
| Antigenic Specificity | Magnesium Transporter 1 (MAGT1) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The function of RP11-217H1.1 protein is not widely studied, and is yet to be elucidated fully. |
|---|
| Immunogen | RP11-217 H1.1 antibody was raised using the N terminal Of Rp11-217 1.1 corresponding to a region with amino acids ARWRFWCVSVTMVVALLIVCDVPSASAQRKKEMVLSEKVSQLMEWTNKRP |
|---|
| Other Names | IAP|MRX95|OST3B|PRO0756|XMEN|bA217H1.1|2410001C15Rik|2610529C04Rik|2810482I07Rik|IAG2|Iag2 |
|---|
| Gene, Accession # | Gene ID: 84061 |
|---|
| Catalog # | ABIN636081 |
|---|
| Price | |
|---|
| Order / More Info | Magnesium Transporter 1 (MAGT1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|