| Edit |   |
|---|
| Antigenic Specificity | Carnitine Palmitoyltransferase 1A (Liver) (CPT1A) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The mitochondrial oxidation of long-chain fatty acids is initiated by the sequential action of carnitine palmitoyltransferase I (which is located in the outer membrane and is detergent-labile) and carnitine palmitoyltransferase II (which is located in the inner membrane and is detergent-stable), together with a carnitine-acylcarnitine translocase. CPT I is the key enzyme in the carnitine-dependent transport across the mitochondrial inner membrane and its deficiency results in a decreased rate of fatty acid beta-oxidation. |
|---|
| Immunogen | CPT1 A antibody was raised using a synthetic peptide corresponding to a region with amino acids LSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLIN |
|---|
| Other Names | MGC53498|CPT1|CPT1-L|L-CPT1|L-CPTI|si:dkey-56p7.8|C730027G07|CPTI|Cpt1|CPT-Ia |
|---|
| Gene, Accession # | Gene ID: 1374 |
|---|
| Catalog # | ABIN635089 |
|---|
| Price | |
|---|
| Order / More Info | Carnitine Palmitoyltransferase 1A (Liver) (CPT1A) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|