| Edit |   |
|---|
| Antigenic Specificity | Carnitine Palmitoyltransferase 1B (Muscle) (CPT1B) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The protein encoded by this gene, a member of the carnitine/choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. |
|---|
| Immunogen | CPT1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA |
|---|
| Other Names | CPTIB|AV080368|Mcp-1|cpt1al|zgc:103709|CPT1B|MGC147544|CPT1-M|CPT1M|CPTI|CPTI-M|M-CPT1|MCCPT1|MCPT1|CPT1|M-CPTI|Cpt1|Cpt1-m|Cpti|Cpti-m|M-cpti|CPT-IB |
|---|
| Gene, Accession # | Gene ID: 1375 |
|---|
| Catalog # | ABIN635060 |
|---|
| Price | |
|---|
| Order / More Info | Carnitine Palmitoyltransferase 1B (Muscle) (CPT1B) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|