| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CUGBP, Elav-Like Family Member 1 (CELF1) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene.Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene. Alternative splicing results in multiple transcript variants encoding different isoforms. |
|---|
| Immunogen | CUGBP1 antibody was raised using the N terminal of CUGBP1 corresponding to a region with amino acids AALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCT |
|---|
| Other Names | CUGBP1|BRUNOL2|CUG-BP|CUGBP|EDEN-BP|NAB50|NAPOR|hNab50|1600010O03Rik|AA407467|Brunol2|CUG-BP1|Cugbp1|D2Wsu101e|HNAB50|Bruno-like|brul|cb920|cugbp1|brunol2|cug-bp|cug-bp1|cugbp|cugbp1-a|eden-bp|edenbp|nab50 |
|---|
| Gene, Accession # | Gene ID: 10658,13046,362160 |
|---|
| Catalog # | ABIN633435 |
|---|
| Price | |
|---|
| Order / More Info | CUGBP, Elav-Like Family Member 1 (CELF1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|