| Edit |   |
|---|
| Antigenic Specificity | Multiple C2 Domains, Transmembrane 1 (MCTP1) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | MCTP1 belongs to the MCTP family.It contains 3 C2 domains. MCTP1 is a multi-pass membrane protein. It binds calcium via the C2 domains in absence of phospholipids. The function of MCTP1 remains unknown. |
|---|
| Immunogen | MCTP1 antibody was raised using the middle region of MCTP1 corresponding to a region with amino acids EVTVYDEDRDRSADFLGKVAIPLLSIQNGEQKAYVLKNKQLTGPTKGVIY |
|---|
| Other Names | MGC157203|MGC108303|2810465F10Rik|Mctp1-ps1|RGD1305199 |
|---|
| Gene, Accession # | Gene ID: 79772 |
|---|
| Catalog # | ABIN635384 |
|---|
| Price | |
|---|
| Order / More Info | Multiple C2 Domains, Transmembrane 1 (MCTP1) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|