| Edit |   |
|---|
| Antigenic Specificity | CTP Synthase (CTPS) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The catalytic conversion of UTP to CTP is accomplished by the enzyme cytidine-5-prime-triphosphate synthetase. The enzyme is important in the biosynthesis of phospholipids and nucleic acids, and plays a key role in cell growth, development and tumorigenesis. |
|---|
| Immunogen | Ctp Synthase antibody was raised using the N terminal of CTPS corresponding to a region with amino acids SMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELR |
|---|
| Other Names | CTPS|DDBDRAFT_0206047|DDBDRAFT_0230162|DDB_0206047|DDB_0230162|Ctps|ACYPI010091|An03g01310|ctps|ctps-b|ctps1-b|CoxI |
|---|
| Gene, Accession # | Gene ID: 17708 |
|---|
| Catalog # | ABIN629603 |
|---|
| Price | |
|---|
| Order / More Info | CTP Synthase (CTPS) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|