| Edit |   |
|---|
| Antigenic Specificity | Kelch-Like 31 (Drosophila) (KLHL31) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat, dog |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | KLHL31 is a transcriptional repressor in MAPK/JNK signaling pathway to regulate cellular functions. Overexpression inhibits the transcriptional activities of both the TPA-response element (TRE) and serum response element (SRE) |
|---|
| Immunogen | KLHL31 antibody was raised using a synthetic peptide corresponding to a region with amino acids TPRGWHCAVTLSDRVYVMGGSQLGPRGERVDVLTVECYSPATGQWSYAAP |
|---|
| Other Names | 9830147P19Rik|D930047P17Rik|Kbtbd1|fb95e08|kbtbd1|klhl|wu:fa31h10|wu:fb95e08|BKLHD6|KBTBD1|KLHL|bA345L23.2|RGD1560540 |
|---|
| Gene, Accession # | Gene ID: 401265,481846,244923,315833 |
|---|
| Catalog # | ABIN634869 |
|---|
| Price | |
|---|
| Order / More Info | Kelch-Like 31 (Drosophila) (KLHL31) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|