| Edit |   |
|---|
| Antigenic Specificity | Kelch-Like 9 (Drosophila) (KLHL9) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | KLHL9 is the substrate-specific adapter for a CUL3-based E3 ubiquitin-protein ligase complex. Within this complex, KLHL9 controls the dynamic behavior of AURKB on mitotic chromosomes and thereby coordinates faithful mitotic progression. |
|---|
| Immunogen | KLHL9 antibody was raised using a synthetic peptide corresponding to a region with amino acids SALKGHLYAVGGRSAAGELATVECYNPRMNEWSYVAKMSEPHYGHAGTVY |
|---|
| Other Names | 8030469P05|C530050O22Rik|ENSMUSG00000070923|mKIAA1354|RGD1304814 |
|---|
| Gene, Accession # | Gene ID: 55958 |
|---|
| Catalog # | ABIN631406 |
|---|
| Price | |
|---|
| Order / More Info | Kelch-Like 9 (Drosophila) (KLHL9) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|