| Edit |   |
| Antigenic Specificity | Ribosomal Protein L13 (RPL13) (C-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, dog |
| Isotype | n/a |
| Format | purified |
| Size | 100 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL13 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L13E family of ribosomal proteins. It is located in the cytoplasm. This gene is expressed at significantly higher levels in benign breast lesions than in breast carcinomas. |
| Immunogen | RPL13 antibody was raised using the C terminal of RPL13 corresponding to a region with amino acids KGDSSAEELKLATQLTGPVMPVRNVYKKEKARVITEEEKNFKAFASLRMA |
| Other Names | Bbc1|CG4651|Dmbbc1|Dmel\\CG4651|L13|Rp L13|Rpl13|anon-EST:fe1D1|bbc1|rpL13|zgc:92272|BBC1|D16S444E|D16S44E|A52 |
| Gene, Accession # | Gene ID: 6137,479612,270106 |
| Catalog # | ABIN630043 |
| Price | |
| Order / More Info | Ribosomal Protein L13 (RPL13) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |