| Edit |   |
|---|
| Antigenic Specificity | Ribosomal Protein L8 (RPL8) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat, dog, zebrafish |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL8 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L2P family of ribosomal proteins. It is located in the cytoplasm. |
|---|
| Immunogen | RPL8 antibody was raised using the C terminal of RPL8 corresponding to a region with amino acids KKVISSANRAVVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRVRGVAM |
|---|
| Other Names | CG1263|Dmel\\CG1263|L8|M(3)62F|M(3)LS2|Rp L8|anon-EST:Posey5|rpL8|zgc:73105|zgc:77641 |
|---|
| Gene, Accession # | Gene ID: 393686,6132,475130,26961,26962 |
|---|
| Catalog # | ABIN630002 |
|---|
| Price | |
|---|
| Order / More Info | Ribosomal Protein L8 (RPL8) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|