| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Dishevelled Associated Activator of Morphogenesis 1 (DAAM1) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The protein encoded by this gene contains FH domains and belongs to a novel FH protein subfamily implicated in cell polarity. Wnt/Fz signaling activates the small GTPase Rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Activation requires Dvl-Rho complex formation, an assembly mediated by this gene product, which is thought to function as a scaffolding protein. |
|---|
| Immunogen | DAAM1 antibody was raised using the middle region of DAAM1 corresponding to a region with amino acids GNTVQYWLLLDRIIQQIVIQNDKGQDPDSTPLENFNIKNVVRMLVNENEV |
|---|
| Other Names | daam-1|xdaam1|DAAM1|DKFZp468D0524|1700066F09Rik|2310028E21Rik|AI503486|E130308H01|mKIAA0666|daam1 |
|---|
| Gene, Accession # | Gene ID: 23002,208846,314212 |
|---|
| Catalog # | ABIN630809 |
|---|
| Price | |
|---|
| Order / More Info | Dishevelled Associated Activator of Morphogenesis 1 (DAAM1) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|