| Edit |   |
| Antigenic Specificity | Dishevelled, Dsh Homolog 1 (Drosophila) (DVL1) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | purified |
| Size | 100 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | DVL1 is a cytoplasmic phosphoprotein that regulates cell proliferation, acting as a transducer molecule for developmental processes, including segmentation and neuroblast specification. DVL1 gene is a candidate for neuroblastomatous transformation. The Schwartz-Jampel syndrome and Charcot-Marie-Tooth disease type 2A have been mapped to the same region as DVL1 gene. The phenotypes of these diseases may be consistent with defects which might be expected from aberrant expression of a DVL gene during development. |
| Immunogen | DVL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNK |
| Other Names | Xdsh|dsh1|dvl-1|DVL|DVL1L1|DVL1P1|DSH|DVL-22|DVL1|DVL4|Dvl|mKIAA4029|DVL-1|dvl1|dvl2l |
| Gene, Accession # | Gene ID: 8215 |
| Catalog # | ABIN630211 |
| Price | |
| Order / More Info | Dishevelled, Dsh Homolog 1 (Drosophila) (DVL1) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |