| Edit |   |
| Antigenic Specificity | LANCL2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LANCL2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LANCL2. This antibody reacts with human. The LANCL2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to LANCL2(LanC lantibiotic synthetase component C-like 2 (bacterial)) The peptide sequence was selected form the middle region of LANCL2. Peptide sequence EMVKPSIDYVRHKKFRSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYK. |
| Other Names | G protein-coupled receptor 69B, GPR69B, LanC (bacterial lantibiotic synthetase component C)-like 2, LanC lantibiotic synthetase component C-like 2 (bacterial), lanC-like protein 2, TASPMGC87139, Testis-specific adriamycin sensitivity protein |
| Gene, Accession # | LANCL2, Gene ID: 55915, Accession: Q9NS86, SwissProt: Q9NS86 |
| Catalog # | NBP1-54862 |
| Price | |
| Order / More Info | LANCL2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |