| 产品详情 |
| Edit |   |
| Antigenic Specificity | MCT1/SLC16A1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MCT1/SLC16A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MCT1/SLC16A1. This antibody reacts with human. The MCT1/SLC16A1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MCT1/SLC16A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGF |
| Other Names | FLJ36745, HHF7, MCT, MCT 1, MCT1MGC44475, member 1, monocarboxylate transporter 1, Solute carrier family 16 member 1, solute carrier family 16, member 1 (monocarboxylic acid transporter 1) |
| Gene, Accession # | SLC16A1, Gene ID: 6566 |
| Catalog # | NBP1-89574 |
| Price | |
| Order / More Info | MCT1/SLC16A1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|