| Edit |   |
|---|
| Antigenic Specificity | Ninjurin 1 (NINJ1) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | NINJ1 is a homophilic cell adhesion molecule that promotes axonal growth. NINJ1 may play a role in nerve regeneration and in the formation and function of other tissues. |
|---|
| Immunogen | Ninjurin 1 antibody was raised using the N terminal of NINJ1 corresponding to a region with amino acids DSGTEEYELNGGLPPGTPGSPDASPARWGWRHGPINVNHYASKKSAAESM |
|---|
| Other Names | nin1|MGC79511|ninjurin|NIN1|NINJURIN|AU024536 |
|---|
| Gene, Accession # | Gene ID: 4814 |
|---|
| Catalog # | ABIN634689 |
|---|
| Price | |
|---|
| Order / More Info | Ninjurin 1 (NINJ1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|