| 产品详情 |
| Edit |   |
| Antigenic Specificity | AKR1C2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The AKR1C2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AKR1C2. This antibody reacts with human. The AKR1C2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human AKR1C2 (NP_995317). Peptide sequence: LEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSK |
| Other Names | aldo-keto reductase family 1 member C2, aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acidbinding protein; 3-alpha hydroxysteroid dehydrogenase, type III), BABP, Chlordecone reductase homolog HAKRD, DD, DD-2, DD2DD/BABP, DDH2FLJ53800, Dihydrodiol dehydrogenase 2, Dihydrodiol dehydrogenase/bile acid-binding protein, EC 1.1.1,3-alpha-HSD3, EC 1.1.1.213, EC 1.3.1.20, HAKRDAKR1C-pseudo, HBAB, MCDR2, pseudo-chlordecone reductase, Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase, type II dihydrodiol dehydrogenase, Type III 3-alpha-hydroxysteroid dehydrogenase |
| Gene, Accession # | AKR1C2, Gene ID: 1646, Accession: P52895, SwissProt: P52895 |
| Catalog # | NBP1-57769 |
| Price | |
| Order / More Info | AKR1C2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|