| Edit |   |
|---|
| Antigenic Specificity | O6-Methylguanine-DNA-Methyltransferase (MGMT) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | MGMT is involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) in DNA.MGMT repairs alkylated guanine in DNA by stoichiometrically transferring the alkyl group at the O-6 position to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated. |
|---|
| Immunogen | MGMT antibody was raised using the middle region of MGMT corresponding to a region with amino acids ISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGG |
|---|
| Other Names | AGT|AI267024|Agat |
|---|
| Gene, Accession # | Gene ID: 4255 |
|---|
| Catalog # | ABIN631949 |
|---|
| Price | |
|---|
| Order / More Info | O6-Methylguanine-DNA-Methyltransferase (MGMT) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|