| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATPase, H+ Transporting, Lysosomal 56/58kDa, V1 Subunit B2 (ATP6V1B2) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | ATP6V1B2 is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. ATP6V1B2 is one of two V1 domain B subunit isoforms and is the only B isoform highly expressed in osteoclasts. |
|---|
| Immunogen | ATP6 V6 2 antibody was raised using the N terminal of ATP6 6 2 corresponding to a region with amino acids VSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSG |
|---|
| Other Names | Atp6b1b2|Atp6b2|Vatb|vha55|VATB|ATP6B1B2|ATP6B2|HO57|VPP3|Vma2|atp6v1bb|fj51e01|vatB2|wu:fj51e01|zgc:109771|AI194269|AI790362|R74844 |
|---|
| Gene, Accession # | Gene ID: 526,11966,117596 |
|---|
| Catalog # | ABIN631079 |
|---|
| Price | |
|---|
| Order / More Info | ATPase, H+ Transporting, Lysosomal 56/58kDa, V1 Subunit B2 (ATP6V1B2) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|