| Edit |   |
|---|
| Antigenic Specificity | SEL1L2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SEL1L2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SEL1L2. This antibody reacts with human. The SEL1L2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SEL1L2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: FGSAGGNMMSQMILGYRYLSGINVLQNCEVALSYYKKVADYIADTFEKSEGVPVEKVRLTERPENLSSNSEILDWDIYQYYKFLAERGDVQIQVSL |
|---|
| Other Names | C20orf50, Chromosome 20 Open Reading Frame 50, Protein Sel-1 Homolog 2, Sel-1 Suppressor Of Lin-12-Like 2 (C. Elegans), Sel-1L2, Suppressor Of Lin-12-Like Protein 2 |
|---|
| Gene, Accession # | Gene ID: 80343 |
|---|
| Catalog # | NBP2-32426 |
|---|
| Price | |
|---|
| Order / More Info | SEL1L2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|