| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MGST2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. IHC, WB, ICC/IF reported in scientific literature (PMID: 26656251). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MGST2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MGST2. This antibody reacts with human, mouse. The MGST2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse MGST2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LKYKVTPPAVTGSPEFERVFRAQQNCVEFYPIF |
|---|
| Other Names | EC 2.5.1.18, FLJ27438, GST2MGC14097, MGST-II, microsomal glutathione S-transferase 2, Microsomal GST-2, Microsomal GST-II, truncated microsomal glutathione S-transferase 2 |
|---|
| Gene, Accession # | MGST2, Gene ID: 4258 |
|---|
| Catalog # | NBP1-82653 |
|---|
| Price | |
|---|
| Order / More Info | MGST2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 26656251 |
|---|
| 产品资料 |
|
|