| Edit |   |
|---|
| Antigenic Specificity | RNA (Guanine-9-) Methyltransferase Domain Containing 2 (RG9MTD2) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | RG9MTD2 is a probable RNA methyltransferase. |
|---|
| Immunogen | RG9 MTD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDLIYLTSDSPNILKELDESKAYVIGGLVDHNHHKGLTYKQASDYGINHA |
|---|
| Other Names | RG9MTD2|TRM10|Rg9mtd2|3110023L08Rik|AA794508|Rnmtd2 |
|---|
| Gene, Accession # | Gene ID: 93587 |
|---|
| Catalog # | ABIN630045 |
|---|
| Price | |
|---|
| Order / More Info | RNA (Guanine-9-) Methyltransferase Domain Containing 2 (RG9MTD2) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|