| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RNA Helicase A |
|---|
| Clone | 3G7 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Antibody reactivity against recominant protein and cell lysate for WB. It has also been used for IF, IHC-P and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RNA Helicase A Antibody (3G7) from Novus Biologicals is a mouse monoclonal antibody to RNA Helicase A. This antibody reacts with human. The RNA Helicase A Antibody (3G7) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | DHX9 (NP_001348, 1 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVASPPP |
|---|
| Other Names | DDX9ATP-dependent RNA helicase A, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 9, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 9 (RNA helicase A, nuclear DNAhelicase II; leukophysin), DEAH (Asp-Glu-Ala-His) box polypeptide 9, DEAH box protein 9, EC 3.6.1, EC 3.6.1.15, EC 3.6.4.13, FLJ17406, leukophysin, LKP, NDH II, NDH2, NDHII, Nuclear DNA helicase II, RHA |
|---|
| Gene, Accession # | DHX9, Gene ID: 1660, Accession: NP_001348, SwissProt: NP_001348 |
|---|
| Catalog # | H00001660-M01 |
|---|
| Price | |
|---|
| Order / More Info | RNA Helicase A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 17531811, 20823370, 21106734, 23015696, 23825951, 24223160, 24469107 |
|---|
| 产品资料 |
|
|