| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NOD2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NOD2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NOD2. This antibody reacts with human. The NOD2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human NOD2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VWNKGTWACQKLIAAAQEAQADSQSPKLHGCWDPHSLHPARDLQSHRPAIVRRLHSHVENMLDLAWERGFVSQYECDEIRLPI |
|---|
| Other Names | BLAU, CARD15caspase recruitment domain protein 15, caspase recruitment domain family, member 15, Caspase recruitment domain-containing protein 15, CDACUG, CLR16.3, IBD1NLR family, CARD domain containing 2, Inflammatory bowel disease protein 1, NLRC2, NOD-like receptor C2, nucleotide-binding oligomerization domain 2, nucleotide-binding oligomerization domain containing 2, nucleotide-binding oligomerization domain, leucine rich repeat and CARD domaincontaining 2, nucleotide-binding oligomerization domain-containing protein 2, PSORAS1NOD2B |
|---|
| Gene, Accession # | NOD2, Gene ID: 64127 |
|---|
| Catalog # | NBP2-48752 |
|---|
| Price | |
|---|
| Order / More Info | NOD2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|