| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MRTO4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MRTO4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MRTO4. This antibody reacts with human. The MRTO4 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human MRTO4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YKDNLHQVSKRLRGEVGLLFTNRTKEEVNEWFTKYTEMDYARAGNKAAFTVSLDPGPLEQFPHSMEPQLRQLGLPTALKRGVV |
|---|
| Other Names | C1orf33, chromosome 1 open reading frame 33, dJ657E11.4, mRNA turnover 4 homolog (S. cerevisiae), mRNA turnover protein 4 homolog, MRT4, mRNA turnover 4, homolog, MRT4, mRNA turnover 4, homolog (S. cerevisiae), MRT460S acidic ribosomal protein PO |
|---|
| Gene, Accession # | MRTO4, Gene ID: 51154 |
|---|
| Catalog # | NBP1-88334 |
|---|
| Price | |
|---|
| Order / More Info | MRTO4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|