| 产品详情 |
| Edit |   |
| Antigenic Specificity | CCT8 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CCT8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCT8. This antibody reacts with human, mouse, rat. The CCT8 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat CCT8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LPNLVCCSAKNLRDIDEVSSLLRTSIMSKQYGNEVFLAKLIAQACVSIFPDSGHFNVDNIRVCKILGSGISSSSVLHGMVFKKETEGDVT |
| Other Names | C21orf112, CCTQ, CCT-theta, chaperonin containing TCP1, subunit 8 (theta), chromosome 21 open reading frame 112, D21S246, KIAA0002, PRED71, T-complex protein 1 subunit theta, T-complex protein 1, theta subunit, 10Renal carcinoma antigen NY-REN-15, TCP-1-theta |
| Gene, Accession # | CCT8, Gene ID: 10694 |
| Catalog # | NBP1-88287 |
| Price | |
| Order / More Info | CCT8 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|