| 产品详情 |
| Edit |   |
| Antigenic Specificity | p53 |
| Clone | CL2199 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG1 |
| Format | Protein A purified |
| Size | 25ul |
| Concentration | n/a |
| Applications | Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The p53 Antibody (CL2199) from Novus Biologicals is a mouse monoclonal antibody to p53. This antibody reacts with human. The p53 Antibody (CL2199) has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSR |
| Other Names | Antigen NY-CO-13, FLJ92943, LFS1TRP53, p53, p53 tumor suppressor, P53cellular tumor antigen p53, Phosphoprotein p53, transformation-related protein 53, tumor protein p53, Tumor suppressor p53 |
| Gene, Accession # | TP53, Gene ID: 7157, Accession: P04637, SwissProt: P04637 |
| Catalog # | NBP2-34495-25ul |
| Price | |
| Order / More Info | p53 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|