| Edit |   |
|---|
| Antigenic Specificity | LYPD4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LYPD4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LYPD4. This antibody reacts with human. The LYPD4 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to LYPD4(LY6/PLAUR domain containing 4) The peptide sequence was selected from the N terminal of LYPD4. Peptide sequence MGPQHLRLVQLFCLLGAISTLPRAGALLCYEATASRFRAVAFHNWKWLLM. |
|---|
| Other Names | LY6/PLAUR domain containing 4, ly6/PLAUR domain-containing protein 4, MGC42718, SMR, sperm membrane receptor |
|---|
| Gene, Accession # | LYPD4, Gene ID: 147719, Accession: Q6UWN0, SwissProt: Q6UWN0 |
|---|
| Catalog # | NBP1-58023-20ul |
|---|
| Price | |
|---|
| Order / More Info | LYPD4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|