| Edit |   |
| Antigenic Specificity | LYPD5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LYPD5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LYPD5. This antibody reacts with human. The LYPD5 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to LYPD5(LY6/PLAUR domain containing 5) The peptide sequence was selected from the N terminal of LYPD5. Peptide sequence WTGPPAGQTQSNADALPPDYSVVRGCTTDKCNAHLMTHDALPNLSQAPDP. |
| Other Names | FLJ30469, LY6/PLAUR domain containing 5, ly6/PLAUR domain-containing protein 5, metastasis-associated protein, PRO4356 |
| Gene, Accession # | LYPD5, Gene ID: 284348, Accession: Q6UWN5-2, SwissProt: Q6UWN5-2 |
| Catalog # | NBP1-56803-20ul |
| Price | |
| Order / More Info | LYPD5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |