| Edit |   |
|---|
| Antigenic Specificity | LYPD6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LYPD6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LYPD6. This antibody reacts with human. The LYPD6 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to LYPD6(LY6/PLAUR domain containing 6) The peptide sequence was selected from the middle region of LYPD6. Peptide sequence RDSEHEGHKVCTSCCEGNICNLPLPRNETDATFATTSPINQTNGHPRCMS. |
|---|
| Other Names | LY6/PLAUR domain containing 6, UNQ3023/PRO9821 |
|---|
| Gene, Accession # | LYPD6, Gene ID: 130574 |
|---|
| Catalog # | NBP1-70629 |
|---|
| Price | |
|---|
| Order / More Info | LYPD6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|