| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | LYPLA3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LYPLA3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LYPLA3. This antibody reacts with human. The LYPLA3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human LYPLA3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLL |
|---|
| Other Names | 1-O-acylceramide synthase, ACSDKFZp564A0122, EC 2.3.1.43, GXVPLA2, LLPLLCAT-like lysophospholipase, LPLA2group XV phospholipase A2, LYPLA3EC 2.3.1.-, Lysophospholipase 3, lysophospholipase 3 (lysosomal phospholipase A2), Lysosomal phospholipase A2, phospholipase A2, group XV |
|---|
| Gene, Accession # | PLA2G15, Gene ID: 23659 |
|---|
| Catalog # | NBP1-92089 |
|---|
| Price | |
|---|
| Order / More Info | LYPLA3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|