| 产品详情 |
| Edit |   |
| Antigenic Specificity | Lyp/PTPN22 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. HIER pH6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Lyp/PTPN22 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Lyp/PTPN22. This antibody reacts with human. The Lyp/PTPN22 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Lyp/PTPN22 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SEISAKEELVLHPAKSSTSFDFLELNYSFDKNADTTMKWQTKAFPIVGEPLQKHQSLDLGSLLFEGCSNSKPVNAAGRYFNSKVPITRTKS |
| Other Names | EC 3.1.3.48, Hematopoietic cell protein-tyrosine phosphatase 70Z-PEP, Lymphoid phosphatase, lymphoid-specific protein tyrosine phosphatase, LYP, Lyp1, LYP2, PEP, PEST-domain phosphatase, protein tyrosine phosphatase, non-receptor type 22 (lymphoid), protein tyrosine phosphatase, non-receptor type 8, PTPN8LYP1, tyrosine-protein phosphatase non-receptor type 22 |
| Gene, Accession # | PTPN22, Gene ID: 26191 |
| Catalog # | NBP1-81277 |
| Price | |
| Order / More Info | Lyp/PTPN22 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|