| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MiRP2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MiRP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MiRP2. This antibody reacts with human. The MiRP2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human MiRP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: METTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASLPGRDDN |
|---|
| Other Names | cardiac voltage-gated potassium channel accessory subunit, DKFZp781H21101, HOKPPMGC102685, HYPP, MGC129924, Minimum potassium ion channel-related peptide 2, MinK-related peptide 2, MiRP2, Potassium channel subunit beta MiRP2, potassium voltage-gated channel subfamily E member 3, potassium voltage-gated channel, Isk-related family, member 3, voltage-gated K+ channel subunit MIRP2 |
|---|
| Gene, Accession # | KCNE3, Gene ID: 10008 |
|---|
| Catalog # | NBP1-83238 |
|---|
| Price | |
|---|
| Order / More Info | MiRP2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|