| Edit |   |
|---|
| Antigenic Specificity | Homez |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Homez Antibody from Novus Biologicals is a rabbit polyclonal antibody to Homez. This antibody reacts with mouse. The Homez Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of mouse HOMEZ. Peptide sequence LSPLAPSEQPTHMKGLKVEPEEPSQVSQLPLNHQNAKEPLMMGSRTFSHQ. |
|---|
| Other Names | homeobox and leucine zipper encoding, homeobox and leucine zipper protein Homez, KIAA1443Homeodomain leucine zipper-containing factor |
|---|
| Gene, Accession # | HOMEZ, Gene ID: 57594, Accession: NP_898997 |
|---|
| Catalog # | NBP1-80267 |
|---|
| Price | |
|---|
| Order / More Info | Homez Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|