| Edit |   |
|---|
| Antigenic Specificity | C19orf25 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The C19orf25 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C19orf25. This antibody reacts with human. The C19orf25 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the n terminal of human C19orf25. Peptide sequence MGSKAKKRVLLPTRPAPPTVEQILEDVRGAPAEDPVFTILAPEDPPVPFR. |
|---|
| Other Names | chromosome 19 open reading frame 25, FLJ36666, hypothetical protein LOC148223 |
|---|
| Gene, Accession # | C19ORF25, Gene ID: 148223, Accession: BAC04262, SwissProt: BAC04262 |
|---|
| Catalog # | NBP1-91526-20ul |
|---|
| Price | |
|---|
| Order / More Info | C19orf25 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|