| Edit |   |
| Antigenic Specificity | C19orf47 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The C19orf47 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C19orf47. This antibody reacts with human. The C19orf47 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to C19ORF47 The peptide sequence was selected from the middle region of C19ORF47. Peptide sequence YVINMPKGTTPRTRKILEQQQAAKGLHRTSVFDRLGAETKADTTTGSKPT. |
| Other Names | chromosome 19 open reading frame 47, DKFZp686P05129, FLJ36888, hypothetical protein LOC126526 |
| Gene, Accession # | C19ORF47, Gene ID: 126526 |
| Catalog # | NBP1-70446 |
| Price | |
| Order / More Info | C19orf47 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |