| Edit |   |
|---|
| Antigenic Specificity | HORMAD1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HORMAD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HORMAD1. This antibody reacts with human. The HORMAD1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human HORMAD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DKDVEDEQEHYTSDDLDIETKMEEQEKNPASSELEEPSLVCEEDEIMRSKESPDLSISHSQVEQLVNK |
|---|
| Other Names | Cancer/testis antigen 46, CT46DKFZP434A1315, HORMA domain containing 1, HORMA domain-containing protein 1, Newborn ovary HORMA protein, NOHMADKFZp434A1315 |
|---|
| Gene, Accession # | HORMAD1, Gene ID: 84072 |
|---|
| Catalog # | NBP2-54973 |
|---|
| Price | |
|---|
| Order / More Info | HORMAD1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|