| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Pin1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Pin1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Pin1. This antibody reacts with human. The Pin1 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human Pin1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE |
|---|
| Other Names | dod, EC 5.2.1.8, peptidyl-prolyl cis/trans isomerase, NIMA-interacting, peptidylprolyl cis/trans isomerase, NIMA-interacting 1, peptidyl-prolyl cis-trans isomerase NIMA-interacting 1, Peptidyl-prolyl cis-trans isomerase Pin1, PPIase Pin1, prolyl isomerase, protein (peptidyl-prolyl cis/trans isomerase) NIMA-interacting 1, protein (peptidylprolyl cis/trans isomerase) NIMA-interacting 1, Rotamase Pin1, UBL5 |
|---|
| Gene, Accession # | PIN1, Gene ID: 5300 |
|---|
| Catalog # | NBP2-55706 |
|---|
| Price | |
|---|
| Order / More Info | Pin1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|