| 产品详情 |
| Edit |   |
| Antigenic Specificity | GPAA1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GPAA1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GPAA1. This antibody reacts with human. The GPAA1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | Synthetic peptides corresponding to GPAA1(glycosylphosphatidylinositol anchor attachment protein 1 homolog (yeast)) The peptide sequence was selected from the C terminal of GPAA1. Peptide sequence LGSLFLWRELQEAPLSLAEGWQLFLAALAQGVLEHHTYGALL |
| Other Names | anchor attachment protein 1 (Gaa1p, yeast) homolog, GAA1 protein homolog, GAA1glycophosphatidylinositol anchor attachment 1, glycosylphosphatidylinositol anchor attachment protein 1 homolog (yeast), GPAA1P anchor attachment protein 1 homolog, GPAA1P anchor attachment protein 1 homolog (yeast), GPI anchor attachment protein 1, GPI transamidase subunit, hGAA1glycosylphosphatidylinositol anchor attachment 1 protein |
| Gene, Accession # | GPAA1, Gene ID: 8733, Accession: O43292, SwissProt: O43292 |
| Catalog # | NBP1-62435 |
| Price | |
| Order / More Info | GPAA1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|