| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GPAT2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. IHC reported in scientific literature (PMID: 24967918). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GPAT2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GPAT2. This antibody reacts with human. The GPAT2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human GPAT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HQKGVFLSQLLGEFSWLTEEILLRGFDVGFSGQLRSLLQHSLSLLRAHVALLRIRQGDLLVVPQPGPGLTHLA |
|---|
| Other Names | ALPAAB, BSCL, BSCL1, cancer/testis antigen 123, CT123, EC 2.3.1.15, glycerol-3-phosphate acyltransferase 2, mitochondrial, GPAT-2, xGPAT1 |
|---|
| Gene, Accession # | GPAT2, Gene ID: 150763 |
|---|
| Catalog # | NBP1-84360 |
|---|
| Price | |
|---|
| Order / More Info | GPAT2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 22905194, 24967918 |
|---|
| 产品资料 |
|
|