| Edit |   |
|---|
| Antigenic Specificity | OAZ2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The OAZ2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to OAZ2. This antibody reacts with human. The OAZ2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to OAZ2(ornithine decarboxylase antizyme 2) The peptide sequence was selected from the middle region of OAZ2. Peptide sequence PDGLLADGSKEGLLALLEFAEEKMKVNYVFICFRKGREDRAPLLKTFSFL. |
|---|
| Other Names | AZ2, ODC-Az 2, ornithine decarboxylase antizyme 2 |
|---|
| Gene, Accession # | OAZ2, Gene ID: 4947 |
|---|
| Catalog # | NBP1-70661-20ul |
|---|
| Price | |
|---|
| Order / More Info | OAZ2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|