| 产品详情 |
| Edit |   |
| Antigenic Specificity | SMG1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SMG1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SMG1. This antibody reacts with human. The SMG1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SMG1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PGSRLSSGGTNYSRSWNDWQPRTDSASADPGNLKYSSSRDRGGSSSYGLQPSNSAVVSRQRHDDTRVHADIQNDEKGGYSVN |
| Other Names | ATXserine/threonine-protein kinase SMG1, EC 2.7.11, EC 2.7.11.1, hSMG-1,61E3.4, KIAA0421phosphatidylinositol 3-kinase-related protein kinase, Lambda/iota protein kinase C-interacting protein, Lambda-interacting protein, LIPPI-3-kinase-related kinase SMG-1, phosphatidylinositol 3-kinase-related kinase, SMG-1, SMG1 homolog, phosphatidylinositol 3-kinase-related kinase (C. elegans) |
| Gene, Accession # | SMG1, Gene ID: 23049 |
| Catalog # | NBP1-88913 |
| Price | |
| Order / More Info | SMG1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|