| Edit |   |
|---|
| Antigenic Specificity | NAPB |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NAPB Antibody from Novus Biologicals is a rabbit polyclonal antibody to NAPB. This antibody reacts with human. The NAPB Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human NAPB. Peptide sequence MDNAGKEREAVQLMAEAEKRVKASHSFLRGLFGGNTRIEEACEMYTRAAN. |
|---|
| Other Names | MGC26066, N-ethylmaleimide-sensitive factor attachment protein, beta, SNAP-BETA |
|---|
| Gene, Accession # | NAPB, Gene ID: 63908, Accession: NP_071363, SwissProt: NP_071363 |
|---|
| Catalog # | NBP1-91515 |
|---|
| Price | |
|---|
| Order / More Info | NAPB Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|