| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NAPE-PLD |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 25ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NAPE-PLD Antibody from Novus Biologicals is a rabbit polyclonal antibody to NAPE-PLD. This antibody reacts with human. The NAPE-PLD Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MKYQHVDPEEAVRIHTDVQTKKSMAIHWGTFALANEHYLEPPVKLNEALERYGLNAEDFFVLKHGESRYLNNDDE |
|---|
| Other Names | C7orf18, DKFZp781D1098, EC 3.1.4, EC 3.1.4.-, N-acyl phosphatidylethanolamine phospholipase DNAPE-PLDFMP30, N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D, NAPE-hydrolyzing phospholipase D |
|---|
| Gene, Accession # | NAPEPLD, Gene ID: 222236 |
|---|
| Catalog # | NBP1-88248-25ul |
|---|
| Price | |
|---|
| Order / More Info | NAPE-PLD Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|