| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GATA-1 |
|---|
| Clone | 3G6 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against cell lysate in WB and recombinant protein in ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GATA-1 Antibody (3G6) from Novus Biologicals is a mouse monoclonal antibody to GATA-1. This antibody reacts with human. The GATA-1 Antibody (3G6) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | GATA1 (ENSP00000365858, 123 a.a. - 199 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DLDGKGSTSFLETLKTERLSPDLLTLGPALPSSLPVPNSAYGGPDFSSTFFSPTGSPLNSAAYSSPKLRGTLPLPPC |
|---|
| Other Names | Eryf1, ERYF1GATA-binding protein 1 (globin transcription factor 1), GATA binding protein 1 (globin transcription factor 1), GATA-1erythroid transcription factor, GATA-binding factor 1, GF-1, GF1globin transcription factor 1, NF-E1 DNA-binding protein, NFE1erythroid transcription factor 1, transcription factor GATA1, XLTT |
|---|
| Gene, Accession # | GATA1, Gene ID: 2623, Accession: NP_002040, SwissProt: NP_002040 |
|---|
| Catalog # | H00002623-M06 |
|---|
| Price | |
|---|
| Order / More Info | GATA-1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|