| Edit |   |
| Antigenic Specificity | TAL2 |
| Clone | 1G6 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2a kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TAL2 Antibody (1G6) from Novus Biologicals is a mouse monoclonal antibody to TAL2. This antibody reacts with human. The TAL2 Antibody (1G6) has been validated for the following applications: Western Blot, ELISA. |
| Immunogen | TAL2 (NP_005412, 29 a.a. - 108 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IPTHPPDKKLSKNETLRLAMRYINFLVKVLGEQSLQQTGVAAQGNILGLFPQGPHLPGLEDRTLLENYQVPSPGPSHHIP |
| Other Names | bHLHa19, Class A basic helix-loop-helix protein 19, TAL-2, T-cell acute lymphocytic leukemia 2, T-cell acute lymphocytic leukemia protein 2 |
| Gene, Accession # | TAL2, Gene ID: 6887, Accession: NP_005412, SwissProt: NP_005412 |
| Catalog # | H00006887-M01 |
| Price | |
| Order / More Info | TAL2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |