| Edit |   |
| Antigenic Specificity | SNX10 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SNX10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SNX10. This antibody reacts with mouse. The SNX10 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is Snx10. Peptide sequence DFLRKVLQNALLLSDSSLHLFLQSHLNSEDIEACVSGQTKYSVEEAIHKF. |
| Other Names | MGC33054, sorting nexin 10, sorting nexin-10 |
| Gene, Accession # | SNX10, Gene ID: 29887, Accession: NP_001120820 |
| Catalog # | NBP1-79562 |
| Price | |
| Order / More Info | SNX10 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |